Lineage for d1xv8b1 (1xv8 B:404-496)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 675783Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 675812Protein Animal alpha-amylase [51024] (3 species)
  7. 675813Species Human (Homo sapiens) [TaxId:9606] [51026] (33 PDB entries)
  8. 675847Domain d1xv8b1: 1xv8 B:404-496 [122342]
    Other proteins in same PDB: d1xv8a2, d1xv8b2
    automatically matched to d1c8qa1
    complexed with ca, cl

Details for d1xv8b1

PDB Entry: 1xv8 (more details), 3 Å

PDB Description: crystal structure of human salivary alpha-amylase dimer
PDB Compounds: (B:) alpha-amylase

SCOP Domain Sequences for d1xv8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xv8b1 b.71.1.1 (B:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1xv8b1:

Click to download the PDB-style file with coordinates for d1xv8b1.
(The format of our PDB-style files is described here.)

Timeline for d1xv8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xv8b2