Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Animal alpha-amylase [51458] (3 species) contains Ca2+-binding subdomain, residues 100-170 |
Species Human (Homo sapiens) [TaxId:9606] [51460] (33 PDB entries) |
Domain d1xv8a2: 1xv8 A:1-403 [122341] Other proteins in same PDB: d1xv8a1, d1xv8b1 automatically matched to d1c8qa2 complexed with ca, cl |
PDB Entry: 1xv8 (more details), 3 Å
SCOP Domain Sequences for d1xv8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xv8a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]} eyssntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaihnpfrpwwe ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrlsglldlalgkdyvrskia eymnhlidigvagfridaskhmwpgdikaildklhnlnsnwfpegskpfiyqevidlgge pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfmpsdralvfvdnhd nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwpryfengkdvndwvgp pndngvtkevtinpdttcgndwvcehrwrqirnmvnfrnvvdg
Timeline for d1xv8a2: