SCOPe 2.08: Domain d1xv8a1: 1xv8 A:409-496

Lineage for d1xv8a1 (1xv8 A:409-496)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries)

8. Domain d1xv8a1: 1xv8 A:409-496 [122340]
   Other proteins in same PDB: d1xv8a2, d1xv8b2
   automated match to d1jxka1
   complexed with ca, cl

Details for d1xv8a1

PDB Entry: 1xv8, 3 Å

PDB Description: crystal structure of human salivary alpha-amylase dimer

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1xv8a1:

Sequence; same for both SEQRES and ATOM records:

>d1xv8a1 b.71.1.0 (A:409-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

Timeline for d1xv8a1:

• d1xv8a1 first appeared in SCOP 1.73
  
• d1xv8a1 appears in SCOPe 2.07