SCOP 1.73: Domain d1xuoa1: 1xuo A:128-308

Lineage for d1xuoa1 (1xuo A:128-308)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (5 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)

6. Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53303] (16 PDB entries)

8. Domain d1xuoa1: 1xuo A:128-308 [122336]
   automatically matched to d1dgqa_
   complexed with la1, mg

Details for d1xuoa1

PDB Entry: 1xuo, 1.8 Å

PDB Description: X-ray structure of LFA-1 I-domain bound to a 1,4-diazepane-2,5-dione inhibitor at 1.8A resolution

PDB Compounds: (A:) Integrin alpha-L

SCOP Domain Sequences for d1xuoa1:

Sequence; same for both SEQRES and ATOM records:

>d1xuoa1 c.62.1.1 (A:128-308) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
v

Timeline for d1xuoa1:

• d1xuoa1 is new in SCOP 1.73
  
• d1xuoa1 appears in SCOP 1.75
  
• d1xuoa1 appears in the current release, SCOPe 2.08, called d1xuoa_