Lineage for d1xtug1 (1xtu G:2-216)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703952Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 703953Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 703954Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)
  6. 704157Protein Uracil PRTase, Upp [53293] (5 species)
  7. 704161Species Sulfolobus solfataricus [TaxId:2287] [142555] (3 PDB entries)
  8. 704180Domain d1xtug1: 1xtu G:2-216 [122310]
    automatically matched to 1XTT A:2-216
    complexed with ctp, u5p

Details for d1xtug1

PDB Entry: 1xtu (more details), 2.8 Å

PDB Description: sulfolobus solfataricus uracil phosphoribosyltransferase in complex with uridine 5'-monophosphate (ump) and cytidine 5'-triphosphate (ctp)
PDB Compounds: (G:) Probable uracil phosphoribosyltransferase

SCOP Domain Sequences for d1xtug1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtug1 c.61.1.1 (G:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]}
plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
kypfiylftvaidpelnnkgyilpglgdagdrafg

SCOP Domain Coordinates for d1xtug1:

Click to download the PDB-style file with coordinates for d1xtug1.
(The format of our PDB-style files is described here.)

Timeline for d1xtug1: