Lineage for d1xttc_ (1xtt C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2499119Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2499120Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2499121Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2499444Protein Uracil PRTase, Upp [53293] (5 species)
  7. 2499448Species Sulfolobus solfataricus [TaxId:2287] [142555] (5 PDB entries)
    Uniprot Q980Q4 2-216
  8. 2499451Domain d1xttc_: 1xtt C: [122302]
    automated match to d1o5oa_
    complexed with acy, u5p

Details for d1xttc_

PDB Entry: 1xtt (more details), 1.8 Å

PDB Description: sulfolobus solfataricus uracil phosphoribosyltransferase in complex with uridine 5'-monophosphate (ump)
PDB Compounds: (C:) Probable uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1xttc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xttc_ c.61.1.1 (C:) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]}
plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
kypfiylftvaidpelnnkgyilpglgdagdrafg

SCOPe Domain Coordinates for d1xttc_:

Click to download the PDB-style file with coordinates for d1xttc_.
(The format of our PDB-style files is described here.)

Timeline for d1xttc_: