SCOPe 2.07: Domain d1xtta1: 1xtt A:2-216

Lineage for d1xtta1 (1xtt A:2-216)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Uracil PRTase, Upp [53293] (5 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [142555] (5 PDB entries)
   Uniprot Q980Q4 2-216

8. Domain d1xtta1: 1xtt A:2-216 [122300]
   complexed with acy, u5p

Details for d1xtta1

PDB Entry: 1xtt, 1.8 Å

PDB Description: sulfolobus solfataricus uracil phosphoribosyltransferase in complex with uridine 5'-monophosphate (ump)

PDB Compounds: (A:) Probable uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1xtta1:

Sequence; same for both SEQRES and ATOM records:

>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]}
plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
kypfiylftvaidpelnnkgyilpglgdagdrafg

Timeline for d1xtta1:

• d1xtta1 first appeared in SCOP 1.73
  
• d1xtta1 appears in SCOPe 2.06
  
• d1xtta1 appears in the current release, SCOPe 2.08