![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (2 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins) |
![]() | Protein Uracil PRTase, Upp [53293] (5 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [142555] (3 PDB entries) |
![]() | Domain d1xtta1: 1xtt A:2-216 [122300] complexed with acy, u5p |
PDB Entry: 1xtt (more details), 1.8 Å
SCOP Domain Sequences for d1xtta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils kypfiylftvaidpelnnkgyilpglgdagdrafg
Timeline for d1xtta1: