Lineage for d1xtsa1 (1xts A:3-169)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830269Protein GTP-binding protein RheB [142275] (1 species)
  7. 830270Species Human (Homo sapiens) [TaxId:9606] [142276] (3 PDB entries)
    Uniprot Q15382 3-169
  8. 830273Domain d1xtsa1: 1xts A:3-169 [122299]
    automatically matched to 1XTQ A:3-169
    complexed with gtp, mg

Details for d1xtsa1

PDB Entry: 1xts (more details), 2.8 Å

PDB Description: structure of small gtpase human rheb in complex with gtp
PDB Compounds: (A:) GTP-binding protein Rheb

SCOP Domain Sequences for d1xtsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtsa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
qsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdta
gqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd
lhmervisyeegkalaeswnaaflessakenqtavdvfrriileaek

SCOP Domain Coordinates for d1xtsa1:

Click to download the PDB-style file with coordinates for d1xtsa1.
(The format of our PDB-style files is described here.)

Timeline for d1xtsa1: