Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 proteins) permutation of the double-SIS domain fold automatically mapped to Pfam PF00342 |
Protein automated matches [190137] (6 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [186861] (1 PDB entry) |
Domain d1xtbb_: 1xtb B: [122296] automated match to d1iria_ complexed with s6p |
PDB Entry: 1xtb (more details), 2 Å
SCOPe Domain Sequences for d1xtbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtbb_ c.80.1.2 (B:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} aaltrnpqfqklqqwhrehgselnlrhlfdtdkerfnhfsltlntnhghilldysknlvt eevmhmlldlaksrgveaaresmfngekinstedravlhvalrnrsntpivvdgkdvmpe vnkvldkmkafcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggprv wfvsnidgthiaktlaclnpesslfiiasktfttqetitnaktakdwfllsakdpstvak hfvalstntakvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsgah wmdqhfrttpleknapvllamlgiwyincfgcetqavlpydqylhrfaayfqqgdmesng kyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkglh hkillanflaqtealmkgksteearkelqaagkspedlmkllphkvfegnrptnsivftk ltpfilgaliamyehkifvqgvvwdinsfdqwgvelgkqlakkiepeldgsspvtshdss tnglinfikqqreaki
Timeline for d1xtbb_: