Lineage for d1xtbb_ (1xtb B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140302Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 protein domains)
    permutation of the double-SIS domain fold
    automatically mapped to Pfam PF00342
  6. 2140362Protein automated matches [190137] (5 species)
    not a true protein
  7. 2140389Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [186861] (1 PDB entry)
  8. 2140391Domain d1xtbb_: 1xtb B: [122296]
    automated match to d1iria_
    complexed with s6p

Details for d1xtbb_

PDB Entry: 1xtb (more details), 2 Å

PDB Description: Crystal Structure of Rabbit Phosphoglucose Isomerase Complexed with Sorbitol-6-Phosphate
PDB Compounds: (B:) phosphoglucose isomerase

SCOPe Domain Sequences for d1xtbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtbb_ c.80.1.2 (B:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aaltrnpqfqklqqwhrehgselnlrhlfdtdkerfnhfsltlntnhghilldysknlvt
eevmhmlldlaksrgveaaresmfngekinstedravlhvalrnrsntpivvdgkdvmpe
vnkvldkmkafcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggprv
wfvsnidgthiaktlaclnpesslfiiasktfttqetitnaktakdwfllsakdpstvak
hfvalstntakvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsgah
wmdqhfrttpleknapvllamlgiwyincfgcetqavlpydqylhrfaayfqqgdmesng
kyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkglh
hkillanflaqtealmkgksteearkelqaagkspedlmkllphkvfegnrptnsivftk
ltpfilgaliamyehkifvqgvvwdinsfdqwgvelgkqlakkiepeldgsspvtshdss
tnglinfikqqreaki

SCOPe Domain Coordinates for d1xtbb_:

Click to download the PDB-style file with coordinates for d1xtbb_.
(The format of our PDB-style files is described here.)

Timeline for d1xtbb_: