![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.80.1: SIS domain [53697] (4 families) ![]() |
![]() | Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 proteins) permutation of the double-SIS domain fold automatically mapped to Pfam PF00342 |
![]() | Protein automated matches [190137] (6 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [186861] (1 PDB entry) |
![]() | Domain d1xtba_: 1xtb A: [122295] automated match to d1iria_ complexed with s6p |
PDB Entry: 1xtb (more details), 2 Å
SCOPe Domain Sequences for d1xtba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtba_ c.80.1.2 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} aaltrnpqfqklqqwhrehgselnlrhlfdtdkerfnhfsltlntnhghilldysknlvt eevmhmlldlaksrgveaaresmfngekinstedravlhvalrnrsntpivvdgkdvmpe vnkvldkmkafcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggprv wfvsnidgthiaktlaclnpesslfiiasktfttqetitnaktakdwfllsakdpstvak hfvalstntakvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsgah wmdqhfrttpleknapvllamlgiwyincfgcetqavlpydqylhrfaayfqqgdmesng kyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkglh hkillanflaqtealmkgksteearkelqaagkspedlmkllphkvfegnrptnsivftk ltpfilgaliamyehkifvqgvvwdinsfdqwgvelgkqlakkiepeldgsspvtshdss tnglinfikqqreaki
Timeline for d1xtba_: