Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins) |
Protein Putative amino-acid transporter CjaA [142814] (1 species) |
Species Campylobacter jejuni [TaxId:197] [142815] (1 PDB entry) |
Domain d1xt8b1: 1xt8 B:10-257 [122294] automatically matched to 1XT8 A:10-257 complexed with cys, gol |
PDB Entry: 1xt8 (more details), 2 Å
SCOP Domain Sequences for d1xt8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xt8b1 c.94.1.1 (B:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} lnsldkikqngvvrigvfgdkppfgyvdekgnnqgydialakriakelfgdenkvqfvlv eaanrveflksnkvdiilanftqtpqraeqvdfcspymkvalgvavpkdsnitsvedlkd ktlllnkgttadayftqnypniktlkydqntetfaalmdkrgdalshdntllfawvkdhp dfkmgikelgnkdviapavkkgdkelkefidnliiklgqeqffhkaydetlkahfgddvk addvvieg
Timeline for d1xt8b1: