![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Putative amino-acid transporter CjaA [142814] (1 species) |
![]() | Species Campylobacter jejuni [TaxId:197] [142815] (1 PDB entry) Uniprot Q0P9S0 29-276 |
![]() | Domain d1xt8b_: 1xt8 B: [122294] automated match to d1xt8a1 complexed with cys, gol |
PDB Entry: 1xt8 (more details), 2 Å
SCOPe Domain Sequences for d1xt8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xt8b_ c.94.1.1 (B:) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} sktlnsldkikqngvvrigvfgdkppfgyvdekgnnqgydialakriakelfgdenkvqf vlveaanrveflksnkvdiilanftqtpqraeqvdfcspymkvalgvavpkdsnitsved lkdktlllnkgttadayftqnypniktlkydqntetfaalmdkrgdalshdntllfawvk dhpdfkmgikelgnkdviapavkkgdkelkefidnliiklgqeqffhkaydetlkahfgd dvkaddvvieg
Timeline for d1xt8b_: