Lineage for d1xt8a1 (1xt8 A:10-257)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009268Protein Putative amino-acid transporter CjaA [142814] (1 species)
  7. 1009269Species Campylobacter jejuni [TaxId:197] [142815] (1 PDB entry)
    Uniprot Q0P9S0 29-276
  8. 1009270Domain d1xt8a1: 1xt8 A:10-257 [122293]
    complexed with cys, gol

Details for d1xt8a1

PDB Entry: 1xt8 (more details), 2 Å

PDB Description: crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution
PDB Compounds: (A:) putative amino-acid transporter periplasmic solute-binding protein

SCOPe Domain Sequences for d1xt8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]}
lnsldkikqngvvrigvfgdkppfgyvdekgnnqgydialakriakelfgdenkvqfvlv
eaanrveflksnkvdiilanftqtpqraeqvdfcspymkvalgvavpkdsnitsvedlkd
ktlllnkgttadayftqnypniktlkydqntetfaalmdkrgdalshdntllfawvkdhp
dfkmgikelgnkdviapavkkgdkelkefidnliiklgqeqffhkaydetlkahfgddvk
addvvieg

SCOPe Domain Coordinates for d1xt8a1:

Click to download the PDB-style file with coordinates for d1xt8a1.
(The format of our PDB-style files is described here.)

Timeline for d1xt8a1: