SCOP 1.75: Domain d1xt8a1: 1xt8 A:10-257

Lineage for d1xt8a1 (1xt8 A:10-257)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Putative amino-acid transporter CjaA [142814] (1 species)

7. Species Campylobacter jejuni [TaxId:197] [142815] (1 PDB entry)
   Uniprot Q0P9S0 29-276

8. Domain d1xt8a1: 1xt8 A:10-257 [122293]
   complexed with cys, gol

Details for d1xt8a1

PDB Entry: 1xt8, 2 Å

PDB Description: crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution

PDB Compounds: (A:) putative amino-acid transporter periplasmic solute-binding protein

SCOP Domain Sequences for d1xt8a1:

Sequence; same for both SEQRES and ATOM records:

>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]}
lnsldkikqngvvrigvfgdkppfgyvdekgnnqgydialakriakelfgdenkvqfvlv
eaanrveflksnkvdiilanftqtpqraeqvdfcspymkvalgvavpkdsnitsvedlkd
ktlllnkgttadayftqnypniktlkydqntetfaalmdkrgdalshdntllfawvkdhp
dfkmgikelgnkdviapavkkgdkelkefidnliiklgqeqffhkaydetlkahfgddvk
addvvieg

Timeline for d1xt8a1:

• d1xt8a1 first appeared in SCOP 1.73
  
• d1xt8a1 appears in SCOPe 2.01
  
• d1xt8a1 appears in the current release, SCOPe 2.08