Lineage for d1xt8a1 (1xt8 A:10-257)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 711108Protein Putative amino-acid transporter CjaA [142814] (1 species)
  7. 711109Species Campylobacter jejuni [TaxId:197] [142815] (1 PDB entry)
  8. 711110Domain d1xt8a1: 1xt8 A:10-257 [122293]
    complexed with cys, gol

Details for d1xt8a1

PDB Entry: 1xt8 (more details), 2 Å

PDB Description: crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution
PDB Compounds: (A:) putative amino-acid transporter periplasmic solute-binding protein

SCOP Domain Sequences for d1xt8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]}
lnsldkikqngvvrigvfgdkppfgyvdekgnnqgydialakriakelfgdenkvqfvlv
eaanrveflksnkvdiilanftqtpqraeqvdfcspymkvalgvavpkdsnitsvedlkd
ktlllnkgttadayftqnypniktlkydqntetfaalmdkrgdalshdntllfawvkdhp
dfkmgikelgnkdviapavkkgdkelkefidnliiklgqeqffhkaydetlkahfgddvk
addvvieg

SCOP Domain Coordinates for d1xt8a1:

Click to download the PDB-style file with coordinates for d1xt8a1.
(The format of our PDB-style files is described here.)

Timeline for d1xt8a1: