Lineage for d1xswa1 (1xsw A:1-38)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030578Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 3030642Protein Kaliotoxin (KTX) [57151] (2 species)
  7. 3030645Species Scorpion (Androctonus mauretanicus mauretanicus) [TaxId:6860] [57152] (3 PDB entries)
  8. 3030647Domain d1xswa1: 1xsw A:1-38 [122288]
    automatically matched to d2ktx__

Details for d1xswa1

PDB Entry: 1xsw (more details)

PDB Description: the solid-state nmr structure of kaliotoxin
PDB Compounds: (A:) Kaliotoxin 1

SCOPe Domain Sequences for d1xswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xswa1 g.3.7.2 (A:1-38) Kaliotoxin (KTX) {Scorpion (Androctonus mauretanicus mauretanicus) [TaxId: 6860]}
gveinvkcsgspqclkpckdagmrfgkcmnrkchctpk

SCOPe Domain Coordinates for d1xswa1:

Click to download the PDB-style file with coordinates for d1xswa1.
(The format of our PDB-style files is described here.)

Timeline for d1xswa1: