Lineage for d1xspa2 (1xsp A:329-385)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329531Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329532Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2329710Protein DNA polymerase lambda [101253] (1 species)
  7. 2329711Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries)
  8. 2329720Domain d1xspa2: 1xsp A:329-385 [122286]
    Other proteins in same PDB: d1xspa1, d1xspa3
    automatically matched to d1rzta2
    protein/DNA complex; complexed with na, ppv

Details for d1xspa2

PDB Entry: 1xsp (more details), 2.2 Å

PDB Description: crystal structure of human dna polymerase lambda in complex with nicked dna and pyrophosphate
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d1xspa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xspa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d1xspa2:

Click to download the PDB-style file with coordinates for d1xspa2.
(The format of our PDB-style files is described here.)

Timeline for d1xspa2: