SCOP 1.75: Domain d1xsna1: 1xsn A:252-327

Lineage for d1xsna1 (1xsn A:252-327)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase lambda [101251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101252] (17 PDB entries)

8. Domain d1xsna1: 1xsn A:252-327 [122282]
   Other proteins in same PDB: d1xsna2, d1xsna3
   automatically matched to d1nzpa_
   complexed with 2dt, d3t, edo, mg, na; mutant

Details for d1xsna1

PDB Entry: 1xsn, 1.95 Å

PDB Description: crystal structure of human dna polymerase lambda in complex with a one nucleotide dna gap and ddttp

PDB Compounds: (A:) DNA polymerase lambda

SCOP Domain Sequences for d1xsna1:

Sequence; same for both SEQRES and ATOM records:

>d1xsna1 a.60.6.1 (A:252-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
hnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmae
kiieilesghlrkldh

Timeline for d1xsna1:

• d1xsna1 first appeared in SCOP 1.73
  
• d1xsna1 appears in SCOPe 2.01
  
• d1xsna1 appears in the current release, SCOPe 2.08