Lineage for d1xsli3 (1xsl I:386-575)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563564Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2563565Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2563573Family d.218.1.2: DNA polymerase beta-like [81300] (5 protein domains)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2563751Protein DNA polymerase lambda [102943] (1 species)
  7. 2563752Species Human (Homo sapiens) [TaxId:9606] [102944] (27 PDB entries)
  8. 2563765Domain d1xsli3: 1xsl I:386-575 [122278]
    Other proteins in same PDB: d1xsla1, d1xsla2, d1xsle1, d1xsle2, d1xsli1, d1xsli2, d1xslm1, d1xslm2
    automatically matched to d1rzta3
    protein/DNA complex; complexed with cac, mg, na

Details for d1xsli3

PDB Entry: 1xsl (more details), 2.3 Å

PDB Description: crystal structure of human dna polymerase lambda in complex with a one nucleotide dna gap
PDB Compounds: (I:) DNA polymerase lambda

SCOPe Domain Sequences for d1xsli3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsli3 d.218.1.2 (I:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs
rlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldiivvpysefacally
ftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptptekdvfrllgl
pyrepaerdw

SCOPe Domain Coordinates for d1xsli3:

Click to download the PDB-style file with coordinates for d1xsli3.
(The format of our PDB-style files is described here.)

Timeline for d1xsli3: