Lineage for d1xsli2 (1xsl I:329-385)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999483Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1999484Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 protein domains)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1999662Protein DNA polymerase lambda [101253] (1 species)
  7. 1999663Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries)
  8. 1999686Domain d1xsli2: 1xsl I:329-385 [122277]
    Other proteins in same PDB: d1xsla1, d1xsla3, d1xsle1, d1xsle3, d1xsli1, d1xsli3, d1xslm1, d1xslm3
    automatically matched to d1rzta2
    protein/DNA complex; complexed with cac, mg, na

Details for d1xsli2

PDB Entry: 1xsl (more details), 2.3 Å

PDB Description: Crystal Structure of human DNA polymerase lambda in complex with a one nucleotide DNA gap
PDB Compounds: (I:) DNA polymerase lambda

SCOPe Domain Sequences for d1xsli2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsli2 a.60.12.1 (I:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d1xsli2:

Click to download the PDB-style file with coordinates for d1xsli2.
(The format of our PDB-style files is described here.)

Timeline for d1xsli2: