![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
![]() | Protein DNA polymerase lambda [101251] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101252] (15 PDB entries) |
![]() | Domain d1xsli1: 1xsl I:250-327 [122276] Other proteins in same PDB: d1xsla2, d1xsla3, d1xsle2, d1xsle3, d1xsli2, d1xsli3, d1xslm2, d1xslm3 automatically matched to d1nzpa_ complexed with cac, mg, na |
PDB Entry: 1xsl (more details), 2.3 Å
SCOP Domain Sequences for d1xsli1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsli1 a.60.6.1 (I:250-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm aekiieilesghlrkldh
Timeline for d1xsli1: