Lineage for d1xsli1 (1xsl I:250-327)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715907Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2716076Protein DNA polymerase lambda [101251] (1 species)
  7. 2716077Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)
  8. 2716116Domain d1xsli1: 1xsl I:250-327 [122276]
    Other proteins in same PDB: d1xsla2, d1xsla3, d1xsle2, d1xsle3, d1xsli2, d1xsli3, d1xslm2, d1xslm3
    automatically matched to d1nzpa_
    protein/DNA complex; complexed with cac, mg, na

Details for d1xsli1

PDB Entry: 1xsl (more details), 2.3 Å

PDB Description: crystal structure of human dna polymerase lambda in complex with a one nucleotide dna gap
PDB Compounds: (I:) DNA polymerase lambda

SCOPe Domain Sequences for d1xsli1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsli1 a.60.6.1 (I:250-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
aekiieilesghlrkldh

SCOPe Domain Coordinates for d1xsli1:

Click to download the PDB-style file with coordinates for d1xsli1.
(The format of our PDB-style files is described here.)

Timeline for d1xsli1: