SCOP 1.73: Domain d1xsle2: 1xsl E:329-385

Lineage for d1xsle2 (1xsl E:329-385)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain

6. Protein DNA polymerase lambda [101253] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101254] (14 PDB entries)

8. Domain d1xsle2: 1xsl E:329-385 [122274]
   Other proteins in same PDB: d1xsla1, d1xsla3, d1xsle1, d1xsle3, d1xsli1, d1xsli3, d1xslm1, d1xslm3
   automatically matched to d1rzta2
   complexed with cac, mg, na

Details for d1xsle2

PDB Entry: 1xsl, 2.3 Å

PDB Description: crystal structure of human dna polymerase lambda in complex with a one nucleotide dna gap

PDB Compounds: (E:) DNA polymerase lambda

SCOP Domain Sequences for d1xsle2:

Sequence; same for both SEQRES and ATOM records:

>d1xsle2 a.60.12.1 (E:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

Timeline for d1xsle2:

• d1xsle2 is new in SCOP 1.73
  
• d1xsle2 appears in SCOP 1.75
  
• d1xsle2 appears in the current release, SCOPe 2.08