![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.39: Penicillinase repressor [101016] (4 proteins) homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain automatically mapped to Pfam PF03965 |
![]() | Protein automated matches [190136] (1 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [186860] (1 PDB entry) |
![]() | Domain d1xsda_: 1xsd A: [122269] automated match to d1sd4a_ protein/DNA complex |
PDB Entry: 1xsd (more details), 2.7 Å
SCOPe Domain Sequences for d1xsda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsda_ a.4.5.39 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} tnkqveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikry kseniyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdiln diskk
Timeline for d1xsda_: