Lineage for d1xsda1 (1xsd A:5-126)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635674Family a.4.5.39: Penicillinase repressor [101016] (2 proteins)
    homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
  6. 635689Protein Penicillinase repressor BlaI [101019] (2 species)
  7. 635693Species Staphylococcus aureus [TaxId:1280] [109666] (2 PDB entries)
  8. 635696Domain d1xsda1: 1xsd A:5-126 [122269]
    automatically matched to d1sd4a_

Details for d1xsda1

PDB Entry: 1xsd (more details), 2.7 Å

PDB Description: Crystal structure of the BlaI repressor in complex with DNA
PDB Compounds: (A:) Penicillinase repressor

SCOP Domain Sequences for d1xsda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsda1 a.4.5.39 (A:5-126) Penicillinase repressor BlaI {Staphylococcus aureus [TaxId: 1280]}
qveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikrykse
niyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdilndis
kk

SCOP Domain Coordinates for d1xsda1:

Click to download the PDB-style file with coordinates for d1xsda1.
(The format of our PDB-style files is described here.)

Timeline for d1xsda1: