SCOPe 2.08: Domain d1xsda_: 1xsd A:

Lineage for d1xsda_ (1xsd A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.39: Penicillinase repressor [101016] (4 proteins)
   homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
   automatically mapped to Pfam PF03965

6. Protein automated matches [190136] (1 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [186860] (1 PDB entry)

8. Domain d1xsda_: 1xsd A: [122269]
   automated match to d1sd4a_
   protein/DNA complex

Details for d1xsda_

PDB Entry: 1xsd, 2.7 Å

PDB Description: Crystal structure of the BlaI repressor in complex with DNA

PDB Compounds: (A:) Penicillinase repressor

SCOPe Domain Sequences for d1xsda_:

Sequence; same for both SEQRES and ATOM records:

>d1xsda_ a.4.5.39 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tnkqveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikry
kseniyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdiln
diskk

Timeline for d1xsda_:

• d1xsda_ first appeared in SCOP 1.73, called d1xsda1
  
• d1xsda_ appears in SCOPe 2.07