Lineage for d1xrxc_ (1xrx C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325749Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2325750Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2325902Family a.43.1.7: SeqA N-terminal domain-like [140547] (1 protein)
    N-terminal part of Pfam PF03925
  6. 2325903Protein SeqA [140548] (1 species)
    a negative modulator of replication initiation
  7. 2325904Species Escherichia coli [TaxId:562] [140549] (1 PDB entry)
    Uniprot P0AFY8 1-35
  8. 2325907Domain d1xrxc_: 1xrx C: [122266]
    automated match to d1xrxa1
    complexed with ca

Details for d1xrxc_

PDB Entry: 1xrx (more details), 2.15 Å

PDB Description: Crystal structure of a DNA-binding protein
PDB Compounds: (C:) SeqA protein

SCOPe Domain Sequences for d1xrxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrxc_ a.43.1.7 (C:) SeqA {Escherichia coli [TaxId: 562]}
mktievddelysyiashtkhigesasdilrrmlkf

SCOPe Domain Coordinates for d1xrxc_:

Click to download the PDB-style file with coordinates for d1xrxc_.
(The format of our PDB-style files is described here.)

Timeline for d1xrxc_: