Class a: All alpha proteins [46456] (289 folds) |
Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
Family a.43.1.7: SeqA N-terminal domain-like [140547] (1 protein) N-terminal part of Pfam PF03925 |
Protein SeqA [140548] (1 species) a negative modulator of replication initiation |
Species Escherichia coli [TaxId:562] [140549] (1 PDB entry) Uniprot P0AFY8 1-35 |
Domain d1xrxc_: 1xrx C: [122266] automated match to d1xrxa1 complexed with ca |
PDB Entry: 1xrx (more details), 2.15 Å
SCOPe Domain Sequences for d1xrxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xrxc_ a.43.1.7 (C:) SeqA {Escherichia coli [TaxId: 562]} mktievddelysyiashtkhigesasdilrrmlkf
Timeline for d1xrxc_: