SCOPe 2.07: Domain d1xrub2: 1xru B:1-278

Lineage for d1xrub2 (1xru B:1-278)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.13: KduI-like [110318] (1 protein)
   Pfam PF04962: duplication: consists of two germin-like domains

6. Protein 5-keto-4-deoxyuronate isomerase KduI [110319] (2 species)

7. Species Escherichia coli [TaxId:562] [110320] (2 PDB entries)
   Uniprot Q46938 1-266

8. Domain d1xrub2: 1xru B:1-278 [122263]
   Other proteins in same PDB: d1xrua2, d1xrub3
   automated match to d1x8ma_
   complexed with 1pe, zn

Details for d1xrub2

PDB Entry: 1xru, 1.94 Å

PDB Description: Crystal Structure of 5-keto-4-deoxyuronate Isomerase from Eschericia coli

PDB Compounds: (B:) 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase

SCOPe Domain Sequences for d1xrub2:

Sequence; same for both SEQRES and ATOM records:

>d1xrub2 b.82.1.13 (B:1-278) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]}
mdvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsvg
gevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasidt
gtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsmg
ltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavisp
swsihsgvgtkaytfiwgmvgenqvfddmdhvavkeic

Timeline for d1xrub2:

• d1xrub2 first appeared in SCOP 1.73, called d1xrub1
  
• d1xrub2 appears in SCOPe 2.06
  
• d1xrub2 appears in the current release, SCOPe 2.08