Lineage for d1xrub2 (1xru B:1-278)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814924Family b.82.1.13: KduI-like [110318] (1 protein)
    Pfam PF04962: duplication: consists of two germin-like domains
  6. 2814925Protein 5-keto-4-deoxyuronate isomerase KduI [110319] (2 species)
  7. 2814933Species Escherichia coli [TaxId:562] [110320] (2 PDB entries)
    Uniprot Q46938 1-266
  8. 2814935Domain d1xrub2: 1xru B:1-278 [122263]
    Other proteins in same PDB: d1xrua2, d1xrub3
    automated match to d1x8ma_
    complexed with 1pe, zn

Details for d1xrub2

PDB Entry: 1xru (more details), 1.94 Å

PDB Description: Crystal Structure of 5-keto-4-deoxyuronate Isomerase from Eschericia coli
PDB Compounds: (B:) 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase

SCOPe Domain Sequences for d1xrub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrub2 b.82.1.13 (B:1-278) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]}
mdvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsvg
gevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasidt
gtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsmg
ltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavisp
swsihsgvgtkaytfiwgmvgenqvfddmdhvavkeic

SCOPe Domain Coordinates for d1xrub2:

Click to download the PDB-style file with coordinates for d1xrub2.
(The format of our PDB-style files is described here.)

Timeline for d1xrub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xrub3