Lineage for d1xrtb2 (1xrt B:56-365)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683612Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 683751Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 proteins)
  6. 683807Protein Two-domain dihydroorotase [141803] (1 species)
  7. 683808Species Aquifex aeolicus [TaxId:63363] [141804] (2 PDB entries)
  8. 683810Domain d1xrtb2: 1xrt B:56-365 [122261]
    Other proteins in same PDB: d1xrta1, d1xrtb1
    automatically matched to 1XRF A:56-365
    complexed with zn

Details for d1xrtb2

PDB Entry: 1xrt (more details), 1.61 Å

PDB Description: The Crystal Structure of a Novel, Latent Dihydroorotase from Aquifex Aeolicus at 1.7 A Resolution
PDB Compounds: (B:) dihydroorotase

SCOP Domain Sequences for d1xrtb2:

Sequence, based on SEQRES records: (download)

>d1xrtb2 c.1.9.6 (B:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]}
gfidihvhlrdpgqtykediesgsrcavaggfttivcmpntnppidnttvvnyilqksks
vglcrvlptgtitkgrkgkeiadfyslkeagcvaftddgspvmdssvmrkalelasqlgv
pimdhceddklaygvinegevsallglssrapeaeeiqiardgilaqrtgghvhiqhvst
klsleiieffkekgvkitcevnpnhllfterevlnsganarvnpplrkkedrlaliegvk
rgiidcfatdhaphqtfekelvefampgiiglqtalpsalelyrkgiislkkliemftin
pariigvdlg

Sequence, based on observed residues (ATOM records): (download)

>d1xrtb2 c.1.9.6 (B:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]}
gfidihvhlrdpgqtykediesgsrcavaggfttivcmpntnppidnttvvnyilqksks
vglcrvlptgtitkgrkgkeiadfyslkeagcvaftddgspvmdssvmrkalelasqlgv
pimdhceddklaeaeeiqiardgilaqrtgghvhiqhvstklsleiieffkekgvkitce
vnpnhllrlaliegvkrgiidcfatdhaphqtpgiiglqtalpsalelyrkgiislkkli
emftinpariigvdlg

SCOP Domain Coordinates for d1xrtb2:

Click to download the PDB-style file with coordinates for d1xrtb2.
(The format of our PDB-style files is described here.)

Timeline for d1xrtb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xrtb1