![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins) |
![]() | Protein Two-domain dihydroorotase [141686] (1 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [141687] (2 PDB entries) Uniprot O66990 1-55,366-422 |
![]() | Domain d1xrtb1: 1xrt B:1-55,B:366-422 [122260] Other proteins in same PDB: d1xrta2, d1xrtb2 automatically matched to 1XRF A:1-55,A:366-422 complexed with zn |
PDB Entry: 1xrt (more details), 1.61 Å
SCOPe Domain Sequences for d1xrtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xrtb1 b.92.1.3 (B:1-55,B:366-422) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]} mlklivkngyvidpsqnlegefdilvengkikkidknilvpeaeiidakglivcpXtlkl gspaditifdpnkewilneetnlsksrntplwgkvlkgkviytikdgkmvykd
Timeline for d1xrtb1: