SCOPe 2.07: Domain d1xrjb_: 1xrj B:

Lineage for d1xrjb_ (1xrj B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins)

6. Protein Uridine-cytidine kinase 2 [102360] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102361] (10 PDB entries)

8. Domain d1xrjb_: 1xrj B: [122257]
   automated match to d1uj2a_
   complexed with adp, c5p, mg

Details for d1xrjb_

PDB Entry: 1xrj, 2 Å

PDB Description: Rapid structure determination of human uridine-cytidine kinase 2 using a conventional laboratory X-ray source and a single samarium derivative

PDB Compounds: (B:) Uridine-cytidine kinase 2

SCOPe Domain Sequences for d1xrjb_:

Sequence; same for both SEQRES and ATOM records:

>d1xrjb_ c.37.1.6 (B:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
ptkkyadviiprgadnlvainlivqhiqdilng

Timeline for d1xrjb_:

• d1xrjb_ first appeared in SCOP 1.73, called d1xrjb1
  
• d1xrjb_ appears in SCOPe 2.06
  
• d1xrjb_ appears in the current release, SCOPe 2.08