Lineage for d1xrja1 (1xrj A:20-230)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695584Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (5 proteins)
  6. 695608Protein Uridine-cytidine kinase 2 [102360] (1 species)
  7. 695609Species Human (Homo sapiens) [TaxId:9606] [102361] (6 PDB entries)
  8. 695612Domain d1xrja1: 1xrj A:20-230 [122256]
    automatically matched to d1udwb_
    complexed with adp, c5p, mg

Details for d1xrja1

PDB Entry: 1xrj (more details), 2 Å

PDB Description: Rapid structure determination of human uridine-cytidine kinase 2 using a conventional laboratory X-ray source and a single samarium derivative
PDB Compounds: (A:) Uridine-cytidine kinase 2

SCOP Domain Sequences for d1xrja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrja1 c.37.1.6 (A:20-230) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
pfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalkg
qfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegila
fysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclp
tkkyadviiprgadnlvainlivqhiqdiln

SCOP Domain Coordinates for d1xrja1:

Click to download the PDB-style file with coordinates for d1xrja1.
(The format of our PDB-style files is described here.)

Timeline for d1xrja1: