Class b: All beta proteins [48724] (174 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins) |
Protein Two-domain dihydroorotase [141686] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [141687] (2 PDB entries) Uniprot O66990 1-55,366-422 |
Domain d1xrfa1: 1xrf A:1-55,A:366-422 [122254] Other proteins in same PDB: d1xrfa2 complexed with so4, zn |
PDB Entry: 1xrf (more details), 1.65 Å
SCOPe Domain Sequences for d1xrfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xrfa1 b.92.1.3 (A:1-55,A:366-422) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]} mlklivkngyvidpsqnlegefdilvengkikkidknilvpeaeiidakglivcpXtlkl gspaditifdpnkewilneetnlsksrntplwgkvlkgkviytikdgkmvykd
Timeline for d1xrfa1: