SCOP 1.75: Domain d1xr9a2: 1xr9 A:1-181

Lineage for d1xr9a2 (1xr9 A:1-181)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (25 PDB entries)

8. Domain d1xr9a2: 1xr9 A:1-181 [122251]
   Other proteins in same PDB: d1xr9a1, d1xr9b1
   automatically matched to d1a1ma2
   complexed with gol, so4, ure

Details for d1xr9a2

PDB Entry: 1xr9, 1.79 Å

PDB Description: Crystal Structures of HLA-B*1501 in Complex with Peptides from Human UbcH6 and Epstein-Barr Virus EBNA-3

PDB Compounds: (A:) HLA class I histocompatibility antigen, B-15 alpha chain

SCOP Domain Sequences for d1xr9a2:

Sequence; same for both SEQRES and ATOM records:

>d1xr9a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprmaprapwieqegpeyw
dretqisktntqtyreslrnlrgyynqseagshtlqrmygcdvgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaareaeqwrayleglcvewlrrylengketlq
r

Timeline for d1xr9a2:

• d1xr9a2 first appeared in SCOP 1.73
  
• d1xr9a2 appears in SCOPe 2.01
  
• d1xr9a2 appears in the current release, SCOPe 2.08