Lineage for d1xr8a2 (1xr8 A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2544976Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries)
  8. 2544994Domain d1xr8a2: 1xr8 A:1-181 [122248]
    Other proteins in same PDB: d1xr8a1, d1xr8b_
    automatically matched to d1a1ma2
    complexed with gol, pg4, ure

Details for d1xr8a2

PDB Entry: 1xr8 (more details), 2.3 Å

PDB Description: Crystal Structures of HLA-B*1501 in Complex with Peptides from Human UbcH6 and Epstein-Barr Virus EBNA-3
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-15 alpha chain

SCOPe Domain Sequences for d1xr8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xr8a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprmaprapwieqegpeyw
dretqisktntqtyreslrnlrgyynqseagshtlqrmygcdvgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaareaeqwrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1xr8a2:

Click to download the PDB-style file with coordinates for d1xr8a2.
(The format of our PDB-style files is described here.)

Timeline for d1xr8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xr8a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1xr8b_