Lineage for d1xr3a1 (1xr3 A:6-261)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 686426Protein beta-keto acyl carrier protein reductase [51788] (8 species)
  7. 686459Species Streptomyces coelicolor [TaxId:1902] [117408] (4 PDB entries)
  8. 686466Domain d1xr3a1: 1xr3 A:6-261 [122245]
    complexed with isz, nap

Details for d1xr3a1

PDB Entry: 1xr3 (more details), 2.71 Å

PDB Description: Actinorhodin Polyketide Ketoreductase with NADP and the Inhibitor Isoniazid bound
PDB Compounds: (A:) Actinorhodin Polyketide Ketoreductase

SCOP Domain Sequences for d1xr3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xr3a1 c.2.1.2 (A:6-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}
sevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtcdvr
svpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfrvtkqv
lkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgitvnav
cpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayligpgaa
avtaqalnvcgglgny

SCOP Domain Coordinates for d1xr3a1:

Click to download the PDB-style file with coordinates for d1xr3a1.
(The format of our PDB-style files is described here.)

Timeline for d1xr3a1: