Lineage for d1xqrb2 (1xqr B:84-350)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2339057Family a.118.1.21: HspBP1 domain [140822] (1 protein)
    this is a repeat family; one repeat unit is 1xqr A:200-242 found in domain
  6. 2339058Protein Hsp70-binding protein 1 (HspBP1) [140823] (1 species)
  7. 2339059Species Human (Homo sapiens) [TaxId:9606] [140824] (2 PDB entries)
    Uniprot Q9NZL4 87-350
  8. 2339061Domain d1xqrb2: 1xqr B:84-350 [122242]
    Other proteins in same PDB: d1xqra2, d1xqrb3
    automated match to d1xqra1

Details for d1xqrb2

PDB Entry: 1xqr (more details), 2.1 Å

PDB Description: crystal structure of the hspbp1 core domain
PDB Compounds: (B:) HSPBP1 protein

SCOPe Domain Sequences for d1xqrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqrb2 a.118.1.21 (B:84-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}
rgqrgeveqmksclrvlsqpmpptageaeqaadqqeregalelladlcenmdnaadfcql
sgmhllvgryleagaaglrwraaqligtcsqnvaaiqeqvlglgalrkllrlldrdacdt
vrvkalfaisclvreqeagllqflrldgfsvlmramqqqvqklkvksafllqnllvghpe
hkgtlcsmgmvqqlvalvrtehspfhehvlgalcslvtdfpqgvrecrepelgleellrh
rcqllqqheeyqeelefcekllqtcfs

SCOPe Domain Coordinates for d1xqrb2:

Click to download the PDB-style file with coordinates for d1xqrb2.
(The format of our PDB-style files is described here.)

Timeline for d1xqrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xqrb3