![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.21: HspBP1 domain [140822] (1 protein) this is a repeat family; one repeat unit is 1xqr A:200-242 found in domain |
![]() | Protein Hsp70-binding protein 1 (HspBP1) [140823] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140824] (2 PDB entries) Uniprot Q9NZL4 87-350 |
![]() | Domain d1xqrb2: 1xqr B:84-350 [122242] Other proteins in same PDB: d1xqra2, d1xqrb3 automated match to d1xqra1 |
PDB Entry: 1xqr (more details), 2.1 Å
SCOPe Domain Sequences for d1xqrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xqrb2 a.118.1.21 (B:84-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} rgqrgeveqmksclrvlsqpmpptageaeqaadqqeregalelladlcenmdnaadfcql sgmhllvgryleagaaglrwraaqligtcsqnvaaiqeqvlglgalrkllrlldrdacdt vrvkalfaisclvreqeagllqflrldgfsvlmramqqqvqklkvksafllqnllvghpe hkgtlcsmgmvqqlvalvrtehspfhehvlgalcslvtdfpqgvrecrepelgleellrh rcqllqqheeyqeelefcekllqtcfs
Timeline for d1xqrb2: