SCOPe 2.08: Domain d1xqrb2: 1xqr B:84-350

Lineage for d1xqrb2 (1xqr B:84-350)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.21: HspBP1 domain [140822] (1 protein)
   this is a repeat family; one repeat unit is 1xqr A:200-242 found in domain

6. Protein Hsp70-binding protein 1 (HspBP1) [140823] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140824] (2 PDB entries)
   Uniprot Q9NZL4 87-350

8. Domain d1xqrb2: 1xqr B:84-350 [122242]
   Other proteins in same PDB: d1xqra2, d1xqrb3
   automated match to d1xqra1

Details for d1xqrb2

PDB Entry: 1xqr, 2.1 Å

PDB Description: crystal structure of the hspbp1 core domain

PDB Compounds: (B:) HSPBP1 protein

SCOPe Domain Sequences for d1xqrb2:

Sequence; same for both SEQRES and ATOM records:

>d1xqrb2 a.118.1.21 (B:84-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}
rgqrgeveqmksclrvlsqpmpptageaeqaadqqeregalelladlcenmdnaadfcql
sgmhllvgryleagaaglrwraaqligtcsqnvaaiqeqvlglgalrkllrlldrdacdt
vrvkalfaisclvreqeagllqflrldgfsvlmramqqqvqklkvksafllqnllvghpe
hkgtlcsmgmvqqlvalvrtehspfhehvlgalcslvtdfpqgvrecrepelgleellrh
rcqllqqheeyqeelefcekllqtcfs

Timeline for d1xqrb2:

• d1xqrb2 first appeared in SCOP 1.73, called d1xqrb1
  
• d1xqrb2 appears in SCOPe 2.07