SCOP 1.73: Domain d1xqic1: 1xqi C:14-195

Lineage for d1xqic1 (1xqi C:14-195)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [143287] (1 PDB entry)

8. Domain d1xqic1: 1xqi C:14-195 [122239]
   automatically matched to 1XQI A:14-195
   complexed with pge, trs; mutant

Details for d1xqic1

PDB Entry: 1xqi, 2.5 Å

PDB Description: crystal structure analysis of an ndp kinase from pyrobaculum aerophilum

PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d1xqic1:

Sequence; same for both SEQRES and ATOM records:

>d1xqic1 d.58.6.1 (C:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
pvektllilkpdavarglvdeiisrfkkaglkivalkmvkaspeeierfypsseewlqsa
gqkllkayqelgidprakigtddpvevgriikrnlvkymtsgpnvvmvlkgnraveivrk
lvgptsphsappgtirgdysidspdlaaeegrvvfnlvhasdspseaereirfwfreeev
le

Timeline for d1xqic1:

• d1xqic1 is new in SCOP 1.73
  
• d1xqic1 appears in SCOP 1.75
  
• d1xqic1 appears in the current release, SCOPe 2.08, called d1xqic_