Lineage for d1xqic_ (1xqi C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951229Species Pyrobaculum aerophilum [TaxId:13773] [143287] (1 PDB entry)
    Uniprot Q8ZWY4 2-183
  8. 2951232Domain d1xqic_: 1xqi C: [122239]
    automated match to d1xqia1
    complexed with pge, trs

Details for d1xqic_

PDB Entry: 1xqi (more details), 2.5 Å

PDB Description: crystal structure analysis of an ndp kinase from pyrobaculum aerophilum
PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1xqic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqic_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Pyrobaculum aerophilum [TaxId: 13773]}
pvektllilkpdavarglvdeiisrfkkaglkivalkmvkaspeeierfypsseewlqsa
gqkllkayqelgidprakigtddpvevgriikrnlvkymtsgpnvvmvlkgnraveivrk
lvgptsphsappgtirgdysidspdlaaeegrvvfnlvhasdspseaereirfwfreeev
le

SCOPe Domain Coordinates for d1xqic_:

Click to download the PDB-style file with coordinates for d1xqic_.
(The format of our PDB-style files is described here.)

Timeline for d1xqic_: