Lineage for d1xqib_ (1xqi B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2557936Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2557937Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2558094Species Pyrobaculum aerophilum [TaxId:13773] [143287] (1 PDB entry)
    Uniprot Q8ZWY4 2-183
  8. 2558096Domain d1xqib_: 1xqi B: [122238]
    automated match to d1xqia1
    complexed with pge, trs

Details for d1xqib_

PDB Entry: 1xqi (more details), 2.5 Å

PDB Description: crystal structure analysis of an ndp kinase from pyrobaculum aerophilum
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1xqib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqib_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Pyrobaculum aerophilum [TaxId: 13773]}
pvektllilkpdavarglvdeiisrfkkaglkivalkmvkaspeeierfypsseewlqsa
gqkllkayqelgidprakigtddpvevgriikrnlvkymtsgpnvvmvlkgnraveivrk
lvgptsphsappgtirgdysidspdlaaeegrvvfnlvhasdspseaereirfwfreeev
le

SCOPe Domain Coordinates for d1xqib_:

Click to download the PDB-style file with coordinates for d1xqib_.
(The format of our PDB-style files is described here.)

Timeline for d1xqib_: