Lineage for d1xqib1 (1xqi B:14-195)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724101Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [143287] (1 PDB entry)
  8. 724103Domain d1xqib1: 1xqi B:14-195 [122238]
    automatically matched to 1XQI A:14-195
    complexed with pge, trs; mutant

Details for d1xqib1

PDB Entry: 1xqi (more details), 2.5 Å

PDB Description: crystal structure analysis of an ndp kinase from pyrobaculum aerophilum
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d1xqib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqib1 d.58.6.1 (B:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
pvektllilkpdavarglvdeiisrfkkaglkivalkmvkaspeeierfypsseewlqsa
gqkllkayqelgidprakigtddpvevgriikrnlvkymtsgpnvvmvlkgnraveivrk
lvgptsphsappgtirgdysidspdlaaeegrvvfnlvhasdspseaereirfwfreeev
le

SCOP Domain Coordinates for d1xqib1:

Click to download the PDB-style file with coordinates for d1xqib1.
(The format of our PDB-style files is described here.)

Timeline for d1xqib1: