Lineage for d1xqca_ (1xqc A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein automated matches [190059] (14 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187214] (165 PDB entries)
  8. Domain d1xqca_: 1xqc A: [122233]
    automated match to d1qkua_
    complexed with aej

Details for d1xqca_

PDB Entry: 1xqc (more details), 2.05 Å

PDB Description: X-ray structure of ERalpha LBD bound to a tetrahydroisoquinoline SERM ligand at 2.05A resolution
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d1xqca_:

Sequence, based on SEQRES records: (download)

>d1xqca_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllemlda
hr

Sequence, based on observed residues (ATOM records): (download)

>d1xqca_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltlhdqv
hllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatssrfr
mmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlmakagltlq
qqhqrlaqlllilshirhmsnkgmehlysmplydlllemldahr

SCOPe Domain Coordinates for d1xqca_ are not available.

Timeline for d1xqca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xqcb_, d1xqcc_, d1xqcd_