Lineage for d1xpxa_ (1xpx A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305224Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2305282Protein Homeo-prospero domain of Prospero protein [81681] (1 species)
    single domain composed of a homeodomain-homology N-terminal region (1245-1295) and the prospero-specific C-terminal region (1296-1396) that forms a 4-helical bundle
  7. 2305283Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [81682] (2 PDB entries)
  8. 2305285Domain d1xpxa_: 1xpx A: [122230]
    automated match to d1mija_
    protein/DNA complex

Details for d1xpxa_

PDB Entry: 1xpx (more details), 2.8 Å

PDB Description: Structural basis of prospero-DNA interaction; implications for transcription regulation in developing cells
PDB Compounds: (A:) Protein prospero

SCOPe Domain Sequences for d1xpxa_:

Sequence, based on SEQRES records: (download)

>d1xpxa_ a.4.1.1 (A:) Homeo-prospero domain of Prospero protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
kyarqavtegiktpddlliagdselyrvlnlhynrnnhievpqnfrfvvestlreffrai
qggkdteqswkksiykiisrmddpvpeyfkspnfleq

Sequence, based on observed residues (ATOM records): (download)

>d1xpxa_ a.4.1.1 (A:) Homeo-prospero domain of Prospero protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
kyarqavteselyrvlnlhynrnnhievpqnfrfvvestlreffraiqggkdteqswkks
iykiisrmddpvpeyfkspnfleq

SCOPe Domain Coordinates for d1xpxa_:

Click to download the PDB-style file with coordinates for d1xpxa_.
(The format of our PDB-style files is described here.)

Timeline for d1xpxa_: