Lineage for d1xpxa1 (1xpx A:1245-1396)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634288Family a.4.1.1: Homeodomain [46690] (39 proteins)
    Pfam PF00046
  6. 634341Protein Homeo-prospero domain of Prospero protein [81681] (1 species)
    single domain composed of a homeodomain-homology N-terminal region (1245-1295) and the prospero-specific C-terminal region (1296-1396) that forms a 4-helical bundle
  7. 634342Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [81682] (2 PDB entries)
  8. 634344Domain d1xpxa1: 1xpx A:1245-1396 [122230]
    automatically matched to d1mija_

Details for d1xpxa1

PDB Entry: 1xpx (more details), 2.8 Å

PDB Description: Structural basis of prospero-DNA interaction; implications for transcription regulation in developing cells
PDB Compounds: (A:) Protein prospero

SCOP Domain Sequences for d1xpxa1:

Sequence, based on SEQRES records: (download)

>d1xpxa1 a.4.1.1 (A:1245-1396) Homeo-prospero domain of Prospero protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
kyarqavtegiktpddlliagdselyrvlnlhynrnnhievpqnfrfvvestlreffrai
qggkdteqswkksiykiisrmddpvpeyfksp

Sequence, based on observed residues (ATOM records): (download)

>d1xpxa1 a.4.1.1 (A:1245-1396) Homeo-prospero domain of Prospero protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
kyarqavteselyrvlnlhynrnnhievpqnfrfvvestlreffraiqggkdteqswkks
iykiisrmddpvpeyfksp

SCOP Domain Coordinates for d1xpxa1:

Click to download the PDB-style file with coordinates for d1xpxa1.
(The format of our PDB-style files is described here.)

Timeline for d1xpxa1: