Lineage for d1xpof2 (1xpo F:48-129)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399519Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 2399520Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)
    Uniprot P03002
  8. 2399556Domain d1xpof2: 1xpo F:48-129 [122228]
    Other proteins in same PDB: d1xpoa1, d1xpoa3, d1xpob1, d1xpob3, d1xpoc1, d1xpoc3, d1xpod1, d1xpod3, d1xpoe1, d1xpoe3, d1xpof1, d1xpof3
    automatically matched to d1a63_2
    protein/RNA complex; complexed with ags, bcm, mg

Details for d1xpof2

PDB Entry: 1xpo (more details), 3.15 Å

PDB Description: structural mechanism of inhibition of the rho transcription termination factor by the antibiotic bicyclomycin
PDB Compounds: (F:) Rho transcription termination factor

SCOPe Domain Sequences for d1xpof2:

Sequence, based on SEQRES records: (download)

>d1xpof2 b.40.4.5 (F:48-129) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpenarn

Sequence, based on observed residues (ATOM records): (download)

>d1xpof2 b.40.4.5 (F:48-129) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpenn

SCOPe Domain Coordinates for d1xpof2:

Click to download the PDB-style file with coordinates for d1xpof2.
(The format of our PDB-style files is described here.)

Timeline for d1xpof2: