Lineage for d1xpoe3 (1xpo E:130-417)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696819Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (16 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 697173Protein Transcription termination factor Rho, ATPase domain [89676] (1 species)
  7. 697174Species Escherichia coli [TaxId:562] [89677] (5 PDB entries)
  8. 697203Domain d1xpoe3: 1xpo E:130-417 [122226]
    Other proteins in same PDB: d1xpoa1, d1xpoa2, d1xpob1, d1xpob2, d1xpoc1, d1xpoc2, d1xpod1, d1xpod2, d1xpoe1, d1xpoe2, d1xpof1, d1xpof2
    automatically matched to d1pv4a3
    complexed with ags, bcm, mg

Details for d1xpoe3

PDB Entry: 1xpo (more details), 3.15 Å

PDB Description: structural mechanism of inhibition of the rho transcription termination factor by the antibiotic bicyclomycin
PDB Compounds: (E:) Rho transcription termination factor

SCOP Domain Sequences for d1xpoe3:

Sequence, based on SEQRES records: (download)

>d1xpoe3 c.37.1.11 (E:130-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}
kilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmllq
niaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviek
akrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnvee
ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk

Sequence, based on observed residues (ATOM records): (download)

>d1xpoe3 c.37.1.11 (E:130-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}
kilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktmllqniaq
siaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakrl
vehkkdviilldsitrlarayntvvpaltggvdanalhrpkrffgaarnveeggsltiia
talidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttqeel
qkmwilrkiihpmgeidameflinklamtktnddffemmk

SCOP Domain Coordinates for d1xpoe3:

Click to download the PDB-style file with coordinates for d1xpoe3.
(The format of our PDB-style files is described here.)

Timeline for d1xpoe3: